Recombinant Danio rerio Erythropoietin (epo)

epo

Q2XNF5

24-183aa

Danio rerio (Zebrafish) (Brachydanio rerio)

SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS

N-terminal 6xHis-tagged

Yeast

Cardiovascular

Developed Protein

Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Greater than 90% as determined by SDS-PAGE.

Not Test

Full Length of Mature Protein

Liquid or Lyophilized powder

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

19.8 kDa

"Endurance exercise differentially stimulates heart and aXIal muscle development in zebrafish (Danio rerio)."
van der Meulen T., Schipper H., van den Boogaart J.G., Huising M.O., Kranenbarg S., van Leeuwen J.L.
Am. J. Physiol. Regul. Integr. Comp. Physiol. 291:R1040-8 (2006)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Recombinant Protein

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

https://www.cusabio.com/Recombinant-Protein/Recombinant-Danio-rerio-Erythropoietin-epo--12927475.html

25-35 business days

https://www.cusabio.com/uploadfile/protein/1/CSB-YP007743DILa0-SDS.jpg

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.