Loading...

Recombinant Twin-Strep tag Protein, C-Twin-Strep tag | Genprice

Recombinant Twin-Strep tag Protein, C-Twin-Strep tag

CAT:

544-MBS1576225-01

Size:

0.1 mg

This product is intended to Research Use Only. Not for Diagnostic or In Vivo Applications

Price:

Ask

For price, please contact [email protected]

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Recombinant Twin-Strep tag Protein, C-Twin-Strep tag - image 1

Related Products

Cat	Name
MBS1576225-03	Recombinant Twin-Strep tag Protein, C-Twin-Strep tag
MBS1576225-01	Recombinant Twin-Strep tag Protein, C-Twin-Strep tag
MBS1576225-02	Recombinant Twin-Strep tag Protein, C-Twin-Strep tag
MBS8434459-01	PD1 Recombinant Protein C-Twin Strep Tag Lyophilized
MBS8434459-02	PD1 Recombinant Protein C-Twin Strep Tag Lyophilized
MBS8434463-02	PDL1 Recombinant Protein C-Twin Strep Tag Lyophilized
MBS8433800	HVEM Recombinant Protein C-Twin Strep Tag Lyophilized
MBS8433857	LDLR Recombinant Protein C-Twin Strep Tag Lyophilized
MBS8434463-01	PDL1 Recombinant Protein C-Twin Strep Tag Lyophilized
MBS1569236-03	Anti-Twin-Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody

Alternative Products

Cat	Name
PPT-17038	Twin-Strep tag Recombinant Protein
FO1-H528b-25ug	Human FOLR1 Protein, Twin-Strep Tag
FO1-H528b-1mg	Human FOLR1 Protein, Twin-Strep Tag
FO1-H528b-250ug	Human FOLR1 Protein, Twin-Strep Tag
HY-P703132	GABRR1, Human (HEK293, twin-Strep)
YGK29601-01	Recombinant Twin-Strep tag Control Protein (C-terminal)
C17D-04	Recombinant Human CLDN18.2 (N-Twin strep-Flag)
C17D-02	Recombinant Human CLDN18.2 (N-Twin strep-Flag)
YGK29601-02	Recombinant Twin-Strep tag Control Protein (C-terminal)
HY-P703384	SLC15A4, Human (HEK293, twin-Strep, His)