Connexin 45 Antibody / GJC1

Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

P36383

Rabbit

Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody.

Polyclonal

IgG

WB

Antigen affinity purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

After reconstitution, the Connexin 45 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

This Connexin 45 antibody is available for research use only.