PYY Antibody / Peptide YY

Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

P10082

Rabbit

Amino acids YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY were used as the immunogen for the Peptide YY antibody.

Polyclonal

IgG

IHC-P

Purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

After reconstitution, the Peptide YY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

This PYY antibody is available for research use only.