+1 (408)780-0908

CRP Antibody / C-Reactive Protein
C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
P02741
Rabbit
Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA were used as the immunogen for the C Reactive Protein antibody.
Polyclonal
IgG
WB, IHC-P
Purified
0.5mg/ml if reconstituted with 0.2ml sterile DI water
After reconstitution, the C Reactive Protein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
This C Reactive Protein antibody is available for research use only.
Similar Products
Cat | Product Name | Size | Price |
---|---|---|---|