Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

Availability: Made to order

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP71117

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: AP72959

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-EP356423BUA-20ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: AP71117

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-EP356423BUAa6-1mg

Ask for more info: [email protected]

Specifications: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Storage and shipping: Shipped on ice packs (+4Â°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20Â°C/-80Â°C. The shelf life of lyophilized form is 12 months at -20Â°C/-80Â°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4Â°C for up to one week.
Notes: For research use only.
Additional information: N-terminal 6xHis-tagged

Search Product