ω-agatoxin-IVA

Availability: Available

0.1

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

ω-Agatoxin IVa

Availability: Out of stock

Cat: 4030173.01

Ask for more info: [email protected]

Ask for price

ω-Agatoxin IVa

Availability: Out of stock

Cat: 4030173.1

Ask for more info: [email protected]

Ask for price

ω-Agatoxin IVA

Availability: Out of stock

Cat: TP2087-10mg

Ask for more info: [email protected]

Ask for price

ω-Agatoxin IVA

Availability: Out of stock

Cat: TP2087-10mg

Ask for more info: [email protected]

Ask for price

ω-Agatoxin IVA

Availability: Out of stock

Cat: TP2087-1g

Ask for more info: [email protected]

Specifications: Blocker of P/Q-type calcium channel (Cav2.1)
Notes: ω-agatoxin-IVA (ω-AGA IVA) is a peptide originally isolated from funnel web-spider venom Agelenopsis aperta. This peptide is a specific blocker of P/Q-type calcium channel (Cav2.1). It has been reported that ω-agatoxin IVA is a potent blocker of voltage-gated calcium channels in insect and vertebrate central neurons. The binding site for ω-agatoxin IVA has been localized in part to the extracellular S3–S4 loop in repeat IV of the α-1A Ca2+ channels, which is proximal to the S4 sensor domain. This is coherent with its functional effect (no pore-blocking activity, but gating modifier by a shift of channel activation towards more depolarized potentials). This makes this toxin a voltage-dependent blocker of P/Q calcium channels.
Additional information: KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Search Product