Loading cart contents...
Anti-GAPDH Antibody
Seller Gentaur · Catalog number: A00227
(0) Reviews
Availability:
Made to order
Price
0.01 USD*
Size
100ug/vial
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
-
Specifications:
- Clonality: Polyclonal
- Ig type: Rabbit IgG
- Form: Lyophilized
- Specificity: No cross reactivity with other proteins.
- Reactivity: Reacts with: human
- Application: WB
- Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids.
- Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
- Purification: Immunogen affinity purified.
- ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
- Gene Name: GAPDH
- Protein Name: Glyceraldehyde-3-phosphate dehydrogenase
- Gene Full Name: glyceraldehyde-3-phosphate dehydrogenase
- Uniprot ID: P04406
- Entrez GeneID: 2597
-
Storage and shipping:
- Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Shipping Condition: Shipped with wet ice