Loading cart contents...
Anti-HLA-DQB1 Antibody Picoband™
Seller Gentaur · Catalog number: A00106-1
(0) Reviews
Availability:
Available
Price
419.10 USD*
Size
100ug/vial
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Ask for price
Availability: Out of stock
Cat: MBS1750327-5x01mg
Ask for more info: [email protected]
-
Specifications:
- Clonality: Polyclonal
- Ig type: Rabbit IgG
- Form: Lyophilized
- Specificity: No cross reactivity with other proteins.
- Reactivity: Reacts with: human
- Application: WB
- Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Immunogen: A synthetic peptide corresponding to a sequence of human HLA-DQB1 (DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR).
- Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
- Purification: Immunogen affinity purified.
- ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500μg/ml.
- Gene Name: HLA-DQB1
- Protein Name: HLA class II histocompatibility antigen, DQ beta 1 chain
- Gene Full Name: major histocompatibility complex, class II, DQ beta 1
- Uniprot ID: P01920
- Entrez GeneID: 3119
- Storage and shipping: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
- Additional information: Human