Anti-Musashi 1/Msi1 Antibody (monoclonal, 2B9)

Availability: Available

100ug/vial

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: MBS1753248-01mg

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS1753248-5x01mg

Ask for more info: [email protected]

Ask for price

Anti-Musashi 1/Msi1 Antibody

Availability: Out of stock

Cat: MBS1753116-01mg

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS8100511-5x01mL

Ask for more info: [email protected]

Ask for price

Anti-Musashi 1 Antibody

Availability: Out of stock

Cat: MBS8307321-005mL

Ask for more info: [email protected]

Specifications:
- Clonality: Monoclonal
- Ig type: Mouse IgG2b
- Form: Lyophilized
- Specificity: No cross reactivity with other proteins.
- Reactivity: Reacts with: human, mouse, rat
- Application: WB,IHC-P
- Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
- Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
- Purification: Immunogen affinity purified.
- ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500μg/ml.
- Gene Name: MSI1
- Protein Name: RNA-binding protein Musashi homolog 1
- Gene Full Name: musashi RNA binding protein 1
- Uniprot ID: O43347
- Entrez GeneID: 4440
Storage and shipping: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Additional information: Human,Mouse,Rat

Search Product