Recent Posts.

(408)780-0908 [email protected]
…
Loading cart contents...
beta-amyloid peptide 1-40

beta-amyloid peptide 1-40

Seller Gentaur · Catalog number: amp40-1mg

Category product: Business and Industry > Scientific and Laboratory Research

 (0) Reviews
Availability: Available
Price

453.75 USD*

Size
1.0mg
beta-amyloid peptide 1-40
beta-amyloid peptide 1-40

Catalog number: / Size: / Price : USDtest product-price-currency (VAT free)

Go to cart Go to order
Inquiry cart
1
Adres Email: | Edit
2
Details of the inquiry
beta-amyloid peptide 1-40
beta-amyloid peptide 1-40

Catalog number: amp40-1mg / Size: 1.0mg / Price: 453.75 USD (VAT free)

3
Inquiry cart
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Rat beta-Amyloid 1-40 (full length) peptide
Ask for price
Rat beta-Amyloid 1-40 (full length) peptide
Availability: Out of stock
Cat: BAM405-P1
Ask for more info: [email protected]
Human beta-Amyloid 1-40 (full length) peptide
Ask for price
Human beta-Amyloid 1-40 (full length) peptide
Availability: Out of stock
Cat: BAM400-P
Ask for more info: [email protected]
Human Beta-Amyloid 1-40 Control/blocking peptide
Ask for price
Human Beta-Amyloid 1-40 Control/blocking peptide
Availability: Out of stock
Cat: BAM402-P
Ask for more info: [email protected]
Human Beta-Amyloid 1-40 Control/blocking peptide
Ask for price
Human Beta-Amyloid 1-40 Control/blocking peptide
Availability: Out of stock
Cat: BAM402-P
Ask for more info: [email protected]
beta-Amyloid Peptide (1-42), rat
Ask for price
beta-Amyloid Peptide (1-42), rat
Availability: Out of stock
Cat: 5-00460
Ask for more info: [email protected]
  • Details
  • Specifications: Peptide in Stock
  • Storage and shipping: -20℃
  • Notes: Sequence : DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV