Loading cart contents...
RANK L Recombinant Protein
Seller Gentaur · Catalog number: 92-558
(0) Reviews
Availability:
Made to order
Price
0.01 USD*
Size
0.05 mg
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
-
Specifications:
- Tested Applications: N/A
- Applications: This recombinant protein can be used for biological assays. For research use only.
- Predicted Molecular Weight: 22.4 kD
- Physical state: Lyophilized
- Buffer: Lyophilized from a 0.2 um filtered solution of 20mM Tris,150mM NaCl,pH8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
- Concentration: N/A
- NCBI official symbol: TNFSF11
- Accession #: O14788
- Protein GI: N/A
- NCBI gene ID#: 8600
- NCBI official full name: tumor necrosis factor superfamily member 11
- NCBI organism: Homo sapiens
- Peptide sequence: MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
- SWISSPROT #: O14788
- Background Reference 1: N/A
- Background Reference 2: N/A
- Background Reference 3: N/A
- Background Reference 4: N/A
- Background Reference 5: N/A
- Source: E. coli
- Species: Human
- By Source: E. Coli
- By Species: Human
- Fusion tag: N-6 His tag
- Sequence: Ile140-Asp317
- Biology activity: N/A
- Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
-
Storage and shipping: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months. - Notes: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.