Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

Availability: Made to order

20ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP71117

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: AP72959

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-EP356423BUA-20ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: RPC25226-100ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS9422663-002mg

Ask for more info: [email protected]

Specifications: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Additional information: N-terminal 6xHis-tagged

Search Product