Recombinant Human Ciliary neurotrophic factor protein (CNTF) (Active)

Availability: Made to order

5ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP73329

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP002841HU

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS969402-01mg

Ask for more info: [email protected]

Ask for price

Active Ciliary Neurotrophic Factor (CNTF)

Availability: Out of stock

Cat: RPU58617-1mg

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS9422940-05mg

Ask for more info: [email protected]

Specifications: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Additional information: Tag-Free

Search Product