Recombinant Human Interleukin-11 protein (IL11) (Active)

Recombinant Human Interleukin-11 protein (IL11) (Active)

Seller Gentaur · Catalog number: CSB-AP001801HU-10ug

(0) Reviews

Availability: Made to order

Price

0.01 USD*

Size

10ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Recombinant Human Interleukin-11 protein(IL11) (Active)

Ask for price

Recombinant Human Interleukin-11 protein(IL11) (Active)

Availability: Out of stock

Cat: AP73445

Ask for more info: [email protected]

Recombinant Human Interleukin-11 protein (IL11) (Active)

Ask for price

Recombinant Human Interleukin-11 protein (IL11) (Active)

Availability: Out of stock

Cat: CSB-AP001801HU

Ask for more info: [email protected]

Recombinant Human Interleukin-11 protein (IL11) (Active)

Ask for price

Recombinant Human Interleukin-11 protein (IL11) (Active)

Availability: Out of stock

Cat: CSB-AP001801HU-500ug

Ask for more info: [email protected]

Recombinant Human Interleukin-11 protein (IL11) (Active)

Ask for price

Recombinant Human Interleukin-11 protein (IL11) (Active)

Availability: Out of stock

Cat: CSB-AP001801HU

Ask for more info: [email protected]

Recombinant Human Interleukin-11 protein (IL11) (Active)

Ask for price

Recombinant Human Interleukin-11 protein (IL11) (Active)

Availability: Out of stock

Cat: MBS969298-01mg

Ask for more info: [email protected]

Specifications: M+PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Additional information: Tag-Free