Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

Seller Gentaur · Catalog number: CSB-EP848659MHVb1-20ug

Category product: Business and Industry > Scientific and Laboratory Research

 (0) Reviews
Availability: Made to order
Price

0.01 USD*

Size
20ug
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

Catalog number: / Size: / Price : USDtest product-price-currency (VAT free)

Inquiry cart
1
Adres Email: | Edit
2
Details of the inquiry
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial

Catalog number: CSB-EP848659MHVb1-20ug / Size: 20ug / Price: 0.01 USD (VAT free)

3
Inquiry cart
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Recombinant Monkeypox virus Envelope protein A28 homolog(A30L),partial
Ask for price
Availability: Out of stock
Cat: CSB-BP848659MHV
Ask for more info: [email protected]
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial
Ask for price
Availability: Out of stock
Cat: CSB-EP848659MHV
Ask for more info: [email protected]
Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial
Ask for price
Availability: Out of stock
Cat: CSB-EP848659MHV-1mg
Ask for more info: [email protected]
Recombinant Monkeypox Virus C19L Protein, Envelope Protein F13
Ask for price
Availability: Out of stock
Cat: MPXV-0314
Ask for more info: [email protected]
Monkeypox Virus Envelope Protein F13 (MPXV C19L) Protein
Ask for price
Availability: Out of stock
Cat: abx620098-100g
Ask for more info: [email protected]
  • Specifications: QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
  • Additional information: N-terminal 10xHis-tagged and C-terminal Myc-tagged