Recombinant Mouse Interleukin-10 (Il10) (Active)

Availability: Made to order

500ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: CSB-AP004841MO

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP004841MO-1mg

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003351MO

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS969297-001mg

Ask for more info: [email protected]

Ask for price

Mouse Interleukin 10 (IL10) Protein (Active)

Availability: Out of stock

Cat: abx655708-10g

Ask for more info: [email protected]

Specifications: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Additional information: Tag-Free

Search Product