Recent Posts.

(408)780-0908 [email protected]
…
Loading cart contents...
  • Product >
  • Business and Industry >
  • Scientific and Laboratory Research >
  • Cusabio >
  • Recombinant Mouse Interleukin-10 (Il10) (Active)
Recombinant Mouse Interleukin-10 (Il10) (Active)

Recombinant Mouse Interleukin-10 (Il10) (Active)

Seller Gentaur · Catalog number: CSB-AP004841MO-50ug

Category product: Business and Industry > Scientific and Laboratory Research

 (0) Reviews
Availability: Made to order
Price

0.01 USD*

Size
50ug
Recombinant Mouse Interleukin-10 (Il10) (Active)
Recombinant Mouse Interleukin-10 (Il10) (Active)

Catalog number: / Size: / Price : USDtest product-price-currency (VAT free)

Go to cart Go to order
Inquiry cart
1
Adres Email: | Edit
2
Details of the inquiry
Recombinant Mouse Interleukin-10 (Il10) (Active)
Recombinant Mouse Interleukin-10 (Il10) (Active)

Catalog number: CSB-AP004841MO-50ug / Size: 50ug / Price: 0.01 USD (VAT free)

3
Inquiry cart
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Recombinant Mouse Interleukin-10 (Il10) (Active)
Ask for price
Recombinant Mouse Interleukin-10 (Il10) (Active)
Availability: Out of stock
Cat: CSB-AP004841MO
Ask for more info: [email protected]
Recombinant Mouse Interleukin-10 (Il10) (Active)
Ask for price
Recombinant Mouse Interleukin-10 (Il10) (Active)
Availability: Out of stock
Cat: CSB-AP004841MO-1mg
Ask for more info: [email protected]
Recombinant Mouse Interleukin-10 protein (Il10) (Active)
Ask for price
Recombinant Mouse Interleukin-10 protein (Il10) (Active)
Availability: Out of stock
Cat: CSB-AP003351MO
Ask for more info: [email protected]
Recombinant Mouse Interleukin-10 protein (Il10) (Active)
Ask for price
Recombinant Mouse Interleukin-10 protein (Il10) (Active)
Availability: Out of stock
Cat: CSB-AP003351MO
Ask for more info: [email protected]
Mouse Interleukin 10 (IL10) Protein (Active)
Ask for price
Mouse Interleukin 10 (IL10) Protein (Active)
Availability: Out of stock
Cat: abx655708-10g
Ask for more info: [email protected]
  • Details
  • Specifications: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
  • Additional information: Tag-Free