Recombinant Mouse Interleukin-10 protein (Il10) (Active)

Availability: Made to order

10ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP73444

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003351MO

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003351MO-500ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS969453-01mg

Ask for more info: [email protected]

Ask for price, Ask for price, Ask for price, Ask for price, Ask for price

Mouse Interleukin 10 (IL10) Protein (Active)

Availability: InStockInStockInStockInStockInStock

Cat: 20-abx655708

Ask for more info: [email protected]

Specifications: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Additional information: Tag-Free

Search Product