Recombinant Mouse Interleukin-11 protein (Il11) (Active)

Availability: Made to order

500ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP73446

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003361MO

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003361MO-10ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP001801HU-500ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003351MO-500ug

Ask for more info: [email protected]

Specifications: M+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Additional information: Tag-Free

Search Product