Recombinant Mouse Interleukin-21 protein (Il21) (Active)

Availability: Made to order

100ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP73475

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003391MO

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP003391MO-500ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP001881HU-100ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: PKSH031514-20ug

Ask for more info: [email protected]

Specifications: HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Additional information: Tag-Free

Search Product