Mouse CD105/Endoglin, soluble Recombinant Protein
Seller Gentaur · Catalog number: S01-022
(0) Reviews
Availability:
Available
Price
425.28 USD*
Size
5 µg
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Ask for price
Availability: Out of stock
Cat: MBS8122724-5x01mg
Ask for more info: [email protected]
Ask for price
Availability: Out of stock
Cat: MBS2546999-5x01mg
Ask for more info: [email protected]
-
Specifications:
- Gene name: CD105/Endoglin, soluble
- Host: Insect cells
- Label: His-Tag
- Applications: Testing in Progress.
- Species Reactivity/Origin species: Mouse
- Purity: > 90% by SDS-PAGE
- Reconstitution Buffer: water
- Buffer: PBS
- Additives/Stabilizer: None
- Form: lyophilized
- Storage: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sCD105 should be stored in working aliquots at -20°C.
- Reconstitution tips: The lyophilized sCD105 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
- MW: 70-75 kDa
- Length (aa): 558
- Protein Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKDKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
- NCBI GeneID: 13805
- Accession Number Protein: NP_031958
- Accession Numberm RNA: NM_007932
- Uniprot: Q63961
- Chromosomal location: 2 B
- 2 21.4 cM
- Notes: For research use only.