Mouse CD105/Endoglin, soluble Recombinant Protein

Mouse CD105/Endoglin, soluble Recombinant Protein

Seller Gentaur · Catalog number: S01-023

Category product: Business and Industry > Scientific and Laboratory Research

 (0) Reviews
Availability: Available
Price

459.53 USD*

Size
25 µg
Mouse CD105/Endoglin, soluble Recombinant Protein
Mouse CD105/Endoglin, soluble Recombinant Protein

Catalog number: / Size: / Price : USDtest product-price-currency (VAT free)

Inquiry cart
1
Adres Email: | Edit
2
Details of the inquiry
Mouse CD105/Endoglin, soluble Recombinant Protein
Mouse CD105/Endoglin, soluble Recombinant Protein

Catalog number: S01-023 / Size: 25 µg / Price: 459.53 USD (VAT free)

3
Inquiry cart
* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.
Mouse CD105/Endoglin, soluble Recombinant Protein
Ask for price
Availability: Out of stock
Cat: S01-022
Ask for more info: [email protected]
Human CD105/Endoglin, soluble Recombinant Protein
Ask for price
Availability: Out of stock
Cat: S01-024
Ask for more info: [email protected]
Mouse CD105/Endoglin, soluble
Ask for price
Availability: Out of stock
Cat: MBS691635-0005mg
Ask for more info: [email protected]
Recombinant Mouse Endoglin/CD105 protein (His tag)
Ask for price
Availability: Out of stock
Cat: PDEM100092-20ug
Ask for more info: [email protected]
Recombinant Mouse Endoglin/CD105 protein (His tag)
Ask for price
Availability: Out of stock
Cat: MBS2571130-01mg
Ask for more info: [email protected]
  • Specifications:
    • Gene name: CD105/Endoglin, soluble
    • Host: Insect cells
    • Label: His-Tag
    • Applications: Testing in Progress.
    • Species Reactivity/Origin species: Mouse
    • Purity: > 90% by SDS-PAGE
    • Reconstitution Buffer: water
    • Buffer: PBS
    • Additives/Stabilizer: None
    • Form: lyophilized
    • Storage: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sCD105 should be stored in working aliquots at -20°C.
    • Reconstitution tips: The lyophilized sCD105 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
    • MW: 70-75 kDa
    • Length (aa): 558
    • Protein Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKDKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
    • NCBI GeneID: 13805
    • Accession Number Protein: NP_031958
    • Accession Numberm RNA: NM_007932
    • Uniprot: Q63961
    • Chromosomal location: 2 B
    • 2 21.4 cM
  • Notes: For research use only.