Recombinant Human Interleukin-10 protein (IL10) (Active)

Availability: Made to order

500ug

* Net price, excluding transport costs. Contact us to receive the current offer within 24 hours.

Ask for price

Availability: Out of stock

Cat: AP73443

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP001791HU

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP001791HU-10ug

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: MBS969297-5x05mg

Ask for more info: [email protected]

Ask for price

Availability: Out of stock

Cat: CSB-AP004841MO-500ug

Ask for more info: [email protected]

Specifications: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Additional information: Tag-Free

Search Product